DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gskt and MRK1

DIOPT Version :9

Sequence 1:NP_733426.1 Gene:gskt / 318552 FlyBaseID:FBgn0046332 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_010204.1 Gene:MRK1 / 851480 SGDID:S000002237 Length:501 Species:Saccharomyces cerevisiae


Alignment Length:330 Identity:151/330 - (45%)
Similarity:229/330 - (69%) Gaps:13/330 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EISYTDAKVVGNGSFGVVFQAKMVPSNEMVAIKKVLQDRRFKNRELQIMRKLRHDNIITLKWFFF 94
            :|||...:|||:||||||....::.:|:.|||||||||||:|||||:.|:.|.|.|.:.|:::|:
Yeast   161 DISYPTTEVVGHGSFGVVVTTVIIETNQKVAIKKVLQDRRYKNRELETMKMLCHPNTVGLQYYFY 225

  Fly    95 SSGEKRDEVYLNLVMEFLPETLYKVERQYARAKQTLPVNFVRLYMYQLLRSMGYLHSL-GFCHRD 158
            ...|: ||||||||::::|::||:..|.:...|..:|...::.|.|||.:::.|||:: ..||||
Yeast   226 EKDEE-DEVYLNLVLDYMPQSLYQRLRHFVNLKMQMPRVEIKFYAYQLFKALNYLHNVPRICHRD 289

  Fly   159 IKPQNMLLDSETGVLKLCDFGSAKQLISGEPNVSYICSRYYRAPELIFGSTDYTTKIDMWSAGCV 223
            |||||:|:|..|...|:|||||||.|...:||||||||||||||||:||:|:|:.::|:||:.||
Yeast   290 IKPQNLLVDPTTFSFKICDFGSAKCLKPDQPNVSYICSRYYRAPELMFGATNYSNQVDVWSSACV 354

  Fly   224 MSELLLGQLIFPGDSGVDQIVEIVKVMGTPTSEQLHDMNPHYKQFKLPELKPHPWSKVFRIRTPA 288
            ::|||||:.:|.|:||:||:|||:|:||.||.:::..|||:|:....|.:||...:::|:...| 
Yeast   355 IAELLLGKPLFSGESGIDQLVEIIKIMGIPTKDEISGMNPNYEDHVFPNIKPITLAEIFKAEDP- 418

  Fly   289 EAIDLVSKMLIYSPNARVSPLMGCAHPFFDELRQ---DPHQQLPNGRSLPPLFNFTDYEKTIEPD 350
            :.:||::|.|.|.|..|:.||......:|||.::   |.:.:..|.|    :|   |::...|..
Yeast   419 DTLDLLTKTLKYHPCERLVPLQCLLSSYFDETKRCDTDTYVKAQNLR----IF---DFDVETELG 476

  Fly   351 TMPLL 355
            .:||:
Yeast   477 HVPLV 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsktNP_733426.1 STKc_GSK3 30..320 CDD:271039 142/290 (49%)
S_TKc 33..317 CDD:214567 138/284 (49%)
MRK1NP_010204.1 STKc_GSK3 159..449 CDD:271039 141/289 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343775
Domainoid 1 1.000 344 1.000 Domainoid score I149
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 354 1.000 Inparanoid score I387
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000635
OrthoInspector 1 1.000 - - mtm9205
orthoMCL 1 0.900 - - OOG6_100482
Panther 1 1.100 - - O PTHR24057
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X378
TreeFam 1 0.960 - -
1211.750

Return to query results.
Submit another query.