DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gskt and Stkld1

DIOPT Version :9

Sequence 1:NP_733426.1 Gene:gskt / 318552 FlyBaseID:FBgn0046332 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_006498172.1 Gene:Stkld1 / 279029 MGIID:2685557 Length:721 Species:Mus musculus


Alignment Length:296 Identity:69/296 - (23%)
Similarity:123/296 - (41%) Gaps:44/296 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YTDAKVVGNGSFGVVFQAKMVPSNEMVAIKKV-LQDRRFKNR---ELQIMRKLRHDNIITLKWFF 93
            |...:::..|:.||....:.:.:.....||:| ..|....|:   ||..:.||:|.|:......|
Mouse     4 YQLLQMLNPGALGVNLVVEELETETKFLIKQVECIDEHHANKALEELMPLLKLQHPNLSLYHEMF 68

  Fly    94 FSSGEKRDEVYLNLVMEFLPE-TLYKVERQYARAKQTLPVNFVRLYMYQLLRSMGYLHSLGFCHR 157
            .....:...::|.|||::..: |...:.....:.|..:...::...:.|:|.::.|||.|...||
Mouse    69 IMWNNEISSLFLCLVMDYYSQGTFQNIMENKRKLKAVVDTEWMHTMLSQVLDAIEYLHKLNIVHR 133

  Fly   158 DIKPQNMLLDSETGVLKLCDFGS-------AKQLISGEPNV---------SYICSRYYRAPELIF 206
            ::||.|::| ..:|..||.|..|       ||..:..|..|         ...|.:.:.|||.: 
Mouse   134 NLKPSNIVL-VNSGYCKLQDMSSQALMTHEAKWNVRAEEGVWGRLGMSGKGDPCQKSWMAPEAL- 196

  Fly   207 GSTDYTTKIDMWSAGCVMSELLLGQLIFPGDSGVDQIVEIVKVMGTPTSEQLHDMNPHYKQFKLP 271
             ...::||.|:||.||::  |.:....|..|:...|:.:.::          |.........|..
Mouse   197 -KFSFSTKSDIWSLGCII--LDMATCSFLNDTEAMQLRKAIR----------HHPGSLKPILKTM 248

  Fly   272 ELKPHPWSKVFRIRTPAEAIDLVSKMLIYSPNARVS 307
            |.|..|.:.|:.:..|.        ||..:|:.|::
Mouse   249 EEKQIPGTDVYYLLLPF--------MLHINPSDRLA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsktNP_733426.1 STKc_GSK3 30..320 CDD:271039 69/296 (23%)
S_TKc 33..317 CDD:214567 69/296 (23%)
Stkld1XP_006498172.1 S_TKc 4..286 CDD:214567 69/296 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.