DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12056 and MAPR2

DIOPT Version :10

Sequence 1:NP_572535.1 Gene:CG12056 / 31855 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001318286.1 Gene:MAPR2 / 817032 AraportID:AT2G24940 Length:100 Species:Arabidopsis thaliana


Alignment Length:99 Identity:33/99 - (33%)
Similarity:55/99 - (55%) Gaps:2/99 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 FTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDFETYDPE 128
            ||..:|:::||.:|.:|:|:|:.|.||||:.|...||||..|:.|.|:|||.:.  |.....:.:
plant     3 FTAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRAL--GKMSKNEED 65

  Fly   129 TADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVI 162
            .:..:..|...::..|..|...::..|...|||:
plant    66 VSPSLEGLTEKEINTLNDWETKFEAKYPVVGRVV 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 65..>122 CDD:459698 25/56 (45%)
MAPR2NP_001318286.1 Cyt-b5 4..66 CDD:459698 25/63 (40%)

Return to query results.
Submit another query.