DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12056 and Nenf

DIOPT Version :9

Sequence 1:NP_572535.1 Gene:CG12056 / 31855 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_079700.1 Gene:Nenf / 66208 MGIID:1913458 Length:171 Species:Mus musculus


Alignment Length:135 Identity:49/135 - (36%)
Similarity:69/135 - (51%) Gaps:19/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AGQDASIPLAFQAGDDIGTLFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFF 108
            |||   .|...:.|..: .|||..|||::.||||.:|:|||:.|.||||:.|.:.||.|..||..
Mouse    30 AGQ---TPRPAERGPPV-RLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNAL 90

  Fly   109 VGRDAS--VSFISGDFETYDP-ETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVIG----RFY 166
            .|:|:|  |:.:|     .|| :...|...|...:|..|   .|.:.|.|..|..::|    |..
Mouse    91 AGKDSSRGVAKMS-----LDPADLTHDTTGLTAKELEAL---DDVFSKVYKAKYPIVGYTARRIL 147

  Fly   167 DEKGA 171
            :|.|:
Mouse   148 NEDGS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 29/55 (53%)
NenfNP_079700.1 Cyt-b5 45..>100 CDD:278597 28/54 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.