DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12056 and nenf

DIOPT Version :9

Sequence 1:NP_572535.1 Gene:CG12056 / 31855 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001032793.2 Gene:nenf / 571299 ZFINID:ZDB-GENE-050320-129 Length:158 Species:Danio rerio


Alignment Length:134 Identity:42/134 - (31%)
Similarity:65/134 - (48%) Gaps:18/134 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DQAGQDASIPLAFQAGDDIGTLFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYN 106
            |...::||.|:         .|||..||.:::|.|:|:|:|:|:.|.||||:.|.:.|..|..||
Zfish    20 DSKIKNASKPV---------RLFTDEELQRYDGSEDGQPIYMAIKGVVFDVTTGKEFYKKGAPYN 75

  Fly   107 FFVGRDA--SVSFISGDFETYDP-ETADDVLTLKPDDLIGLAG-WRDFYQKDYVYKGRVIGRFYD 167
            ..||:|:  :|:.:|     .|| :...|...|....|..|.. :...|:..|...|....|..:
Zfish    76 ALVGKDSTRAVAKMS-----LDPADLTHDTTGLTESQLQSLEKIFTGTYKTKYPVVGYTSRRLLN 135

  Fly   168 EKGA 171
            |.|:
Zfish   136 EDGS 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 25/55 (45%)
nenfNP_001032793.2 Cyt-b5 32..>87 CDD:278597 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.