DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12056 and cyb5d2

DIOPT Version :9

Sequence 1:NP_572535.1 Gene:CG12056 / 31855 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001016154.1 Gene:cyb5d2 / 548908 XenbaseID:XB-GENE-981419 Length:273 Species:Xenopus tropicalis


Alignment Length:231 Identity:89/231 - (38%)
Similarity:131/231 - (56%) Gaps:9/231 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GTLFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDFETY 125
            |.|.:..||:.::|......:|||:||.||||.:|.||||.|.||:||.|:|||.::::|||.  
 Frog    44 GRLMSKEELSVYDGGPGSSGIYLAILGQVFDVHKGSKHYGPGGSYSFFAGKDASRAYMTGDFT-- 106

  Fly   126 DPETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVIGRFYDEKGALTTYHHKFLELLEQARDAK 190
            :....|||..|.|..::.|..|..|||::|:..|::.||||||.|..|......|::::.....|
 Frog   107 EKGLVDDVTELSPLQMLHLHNWLSFYQQNYITIGKLTGRFYDESGNPTKALEDALKVIDIGLKLK 171

  Fly   191 RQVEELRARYPGCNIEWSEERGTRVWCTTTSGDGKERSWIGYPRKLYSRGNKSFQCACV-----P 250
            .:.||...::|.||.|||.| ..||||:..|| |.:|.|:|.|||:|:.|...::|.||     |
 Frog   172 EEREEENKQFPPCNSEWSSE-SKRVWCSKNSG-GIQRDWVGVPRKMYTAGTNGYRCVCVRNFGPP 234

  Fly   251 DAELDEIDAGGKVAHGDAMLKPYDNCEPQARECFYR 286
            ..:.|..:...:....:.||..|::|.|....||.:
 Frog   235 SEQPDSTEHNDRGDLDNPMLHEYEDCNPLFEWCFLK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 27/53 (51%)
cyb5d2NP_001016154.1 Cyt-b5 48..>109 CDD:365921 29/62 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6799
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14701
Inparanoid 1 1.050 174 1.000 Inparanoid score I3959
OMA 1 1.010 - - QHG59781
OrthoDB 1 1.010 - - D1355837at2759
OrthoFinder 1 1.000 - - FOG0006068
OrthoInspector 1 1.000 - - oto102279
Panther 1 1.100 - - LDO PTHR10281
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2676
SonicParanoid 1 1.000 - - X4364
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.