DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12056 and CG32087

DIOPT Version :9

Sequence 1:NP_572535.1 Gene:CG12056 / 31855 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_729740.2 Gene:CG32087 / 39323 FlyBaseID:FBgn0052087 Length:407 Species:Drosophila melanogaster


Alignment Length:191 Identity:38/191 - (19%)
Similarity:61/191 - (31%) Gaps:67/191 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PAELAKFNGEEEGRPLY--------------LALLGSVFDVSRG--------IKHYGSGCSYNFF 108
            |.:..|:.|.|.|..|.              |.||| :|.:..|        .||......|...
  Fly    40 PVQTLKYGGLEAGHLLLSFIEKLLNLWLVGGLLLLG-MFCLLPGPHADFVIFCKHRFGFAVYWLG 103

  Fly   109 VGRDASVSFISG---------------DFETYDPETADDVLTLKPDDLIGLAGWRDFYQKDYVYK 158
            :|..:||.|.:|               ....|:.:|.|......||..:..   ::.|:::|...
  Fly   104 LGVLSSVGFGTGLHTFLLYLGPHLAAVTLAAYECQTLDFPTPPYPDIKVCP---QEPYKRNYPDV 165

  Fly   159 GRVIGRFYDEK---------GALTTYHHKFLELLEQARDAKRQVEELRARYPGCNIEWSEE 210
            .:::.:...|.         |.|..|   |:              ..|||..|..::.:||
  Fly   166 WQILAKVRPEALLWGIGTALGELPPY---FM--------------TRRARLSGKELDGAEE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 18/72 (25%)
CG32087NP_729740.2 SNARE_assoc <233..282 CDD:294297
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452929
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10281
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.