DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12056 and CG16957

DIOPT Version :10

Sequence 1:NP_572535.1 Gene:CG12056 / 31855 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_609650.1 Gene:CG16957 / 34755 FlyBaseID:FBgn0032519 Length:192 Species:Drosophila melanogaster


Alignment Length:130 Identity:35/130 - (26%)
Similarity:64/130 - (49%) Gaps:9/130 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LRRQTDNYLDQAGQDASIPLAFQAGDDIGTLFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIK 97
            |.|:..::.|...|:..:|       .:...||..||.:::|......:.:|:|.:::||||.:.
  Fly    49 LSREEPDFSDDNNQEVDLP-------PLRKDFTVRELREYDGTRADGRILVAILFNIYDVSRSVH 106

  Fly    98 HYG-SGCSYNFFVGRDASVSFISGDFETYDPETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRV 161
            :|| :|.:.| :.|||.|...|:...:..|.|..||:..|..:.:..|..|...|:..|.:.|::
  Fly   107 YYGRNGVNPN-YAGRDISRILINSPEDLKDSEDFDDLSDLSRNQMNTLREWEQRYKMKYPFVGKL 170

  Fly   162  161
              Fly   171  170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 65..>122 CDD:459698 19/57 (33%)
CG16957NP_609650.1 Cyt-b5 74..>127 CDD:459698 18/53 (34%)

Return to query results.
Submit another query.