DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12056 and c-cup

DIOPT Version :9

Sequence 1:NP_572535.1 Gene:CG12056 / 31855 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_608623.2 Gene:c-cup / 33360 FlyBaseID:FBgn0031367 Length:201 Species:Drosophila melanogaster


Alignment Length:108 Identity:31/108 - (28%)
Similarity:52/108 - (48%) Gaps:11/108 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VVAAVLGGIYHTEIRQFLRR---------QTDNYLDQAGQDASIPLAFQAGDDIGTLFTPAELAK 71
            :|:.::|....|::.||..:         ::..|||...:..|.|...: |.|| .|.|..||..
  Fly    31 LVSFLVGYFVTTKLSQFYGKFKRDSEKSDESTQYLDMYPRKESQPKDTK-GHDI-VLLTLEELTA 93

  Fly    72 FNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDAS 114
            |:|.....|:|.||.|.::|:|.|.:.:.|...|:...|.:|:
  Fly    94 FDGSSPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLAGCNAN 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 18/52 (35%)
c-cupNP_608623.2 Cyt-b5 87..>115 CDD:295147 11/27 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1355837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10281
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.