DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12056 and t-cup

DIOPT Version :9

Sequence 1:NP_572535.1 Gene:CG12056 / 31855 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_723757.1 Gene:t-cup / 318986 FlyBaseID:FBgn0051858 Length:216 Species:Drosophila melanogaster


Alignment Length:133 Identity:26/133 - (19%)
Similarity:59/133 - (44%) Gaps:21/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDFETYDPETADD 132
            :|..|:|......:.:||.|.::|||...:.:|...:.:...|||.: :::....:|::.|    
  Fly    63 QLLGFDGTRSDGRILVALRGKIYDVSSDFEEFGLTGTLSHVAGRDFT-NYLKSIMDTHNSE---- 122

  Fly   133 VLTLKPDDLIGLAGWRDFYQKDYVYKGRVIGRFYDEKG--ALTTYHHKFLELLEQARDAKRQVEE 195
                    :..:..|....:.:|...|.||    ||:|  .:....:..::::|:..:  ..:|.
  Fly   123 --------INYVDRWESILETNYSCVGEVI----DEQGNPLMGKIENHDVDVMEETEE--DMIEP 173

  Fly   196 LRA 198
            ::|
  Fly   174 IKA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 13/48 (27%)
t-cupNP_723757.1 Cyt-b5 72..143 CDD:278597 15/83 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10281
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.