DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12056 and vem-1

DIOPT Version :9

Sequence 1:NP_572535.1 Gene:CG12056 / 31855 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001024770.1 Gene:vem-1 / 181066 WormBaseID:WBGene00006890 Length:183 Species:Caenorhabditis elegans


Alignment Length:164 Identity:39/164 - (23%)
Similarity:73/164 - (44%) Gaps:36/164 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FQF-----LFVVAAVLGGIYHTEIRQFLRRQTDNYLDQAGQDASIPLAFQAGDDIGTLFTPAELA 70
            |:|     :|:| .|||..::     :|.|..........:.|.:|::     |:    |..||.
 Worm     7 FEFTMYDAVFLV-VVLGFFFY-----WLTRSEQPLPAPPKELAPLPMS-----DM----TVEELR 56

  Fly    71 KFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSF-------ISGDFETYDPE 128
            |::|.:....|: .|.|:::||:||...||.|.:|....|.||:.:.       :|.:::.:...
 Worm    57 KYDGVKNEHILF-GLNGTIYDVTRGKGFYGPGKAYGTLAGHDATRALGTMDQNAVSSEWDDHTGI 120

  Fly   129 TADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVI 162
            :||:..|...        |...::..|:..||::
 Worm   121 SADEQETANE--------WETQFKFKYLTVGRLV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 19/53 (36%)
vem-1NP_001024770.1 Cyt-b5 51..>106 CDD:306642 19/55 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.