DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12056 and CYB5D2

DIOPT Version :9

Sequence 1:NP_572535.1 Gene:CG12056 / 31855 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_653212.1 Gene:CYB5D2 / 124936 HGNCID:28471 Length:264 Species:Homo sapiens


Alignment Length:235 Identity:96/235 - (40%)
Similarity:125/235 - (53%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDFETYDP 127
            ||.|.||:::.|......|||||||.|:|||.|.:||..|..|:.|.|||||.:|::||..  :.
Human    37 LFIPEELSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYSGFAGRDASRAFVTGDCS--EA 99

  Fly   128 ETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVIGRFYDEKG----ALTTYHHKFLELLEQARD 188
            ...|||..|...:::.|..|..||:|:||..|||.||||.|.|    |||.........||.   
Human   100 GLVDDVSDLSAAEMLTLHNWLSFYEKNYVCVGRVTGRFYGEDGLPTPALTQVEAAITRGLEA--- 161

  Fly   189 AKRQVEELRARYPGCNIEWSEERGTRVWCTTTSGDGKERSWIGYPRKLYSRGNKSFQCACV---- 249
            .|.|::| :..:|.||.|||..||:|:||:..|| |..|.|||.|||||..|.|..:|.||    
Human   162 NKLQLQE-KQTFPPCNAEWSSARGSRLWCSQKSG-GVSRDWIGVPRKLYKPGAKEPRCVCVRTTG 224

  Fly   250 -PDAELDEIDA---GGKVAHGDAMLKPYDNCEPQARECFY 285
             |..::.:...   .|.:.|.:  |..|..|.|.|..|.:
Human   225 PPSGQMPDNPPHRNRGDLDHPN--LAEYTGCPPLAITCSF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 28/53 (53%)
CYB5D2NP_653212.1 Cyt-b5 40..>100 CDD:306642 29/61 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147910
Domainoid 1 1.000 79 1.000 Domainoid score I8760
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14701
Inparanoid 1 1.050 156 1.000 Inparanoid score I4310
Isobase 1 0.950 - 0 Normalized mean entropy S2222
OMA 1 1.010 - - QHG59781
OrthoDB 1 1.010 - - D1355837at2759
OrthoFinder 1 1.000 - - FOG0006068
OrthoInspector 1 1.000 - - oto88398
orthoMCL 1 0.900 - - OOG6_104240
Panther 1 1.100 - - LDO PTHR10281
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2676
SonicParanoid 1 1.000 - - X4364
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.