DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12057 and CG12115

DIOPT Version :9

Sequence 1:NP_001259379.1 Gene:CG12057 / 31854 FlyBaseID:FBgn0030098 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_572533.1 Gene:CG12115 / 31853 FlyBaseID:FBgn0030097 Length:263 Species:Drosophila melanogaster


Alignment Length:194 Identity:62/194 - (31%)
Similarity:94/194 - (48%) Gaps:14/194 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LDAQVRSVVDEMTSIGKATGEVLL---SQYEEIVLEPQNELEAAVEQVESRREESPECVAAEDEE 89
            ||..:|.::.|..::.|   |::|   .|..:|.|.|..|||...|.||.|..::.||.......
  Fly    72 LDRTLRLLIAESKALAK---EIILLTERQLLKIFLWPIKELEKLAEDVERRALDAGECAINVTSS 133

  Fly    90 ITRIVNAAHEDLYACGVVAAQTSAEIASDVSAATQQLVYGGYSLASTYNKCNSYK-NSVLKQTCL 153
            ...:|.:...|...|...||.||..:..|...|..||...||.|.....:||||| ||:.|:||.
  Fly   134 SADLVASTTLDFLGCARDAAVTSINLVLDTKKAVLQLTLDGYQLYQLRKECNSYKANSIRKKTCK 198

  Fly   154 AKFYVQATVYLVSARSSIK---TIRQSTSERIPDVFADGNVCTHSASSQAVLGLQEVNNNIDAC 214
            .||..:..:|:.:.::|::   .:|:|    :|.|..|...||..::..|:.|..::|..||||
  Fly   199 VKFTTKGILYVANGQASLRYLIRLRKS----VPAVATDATSCTTKSTENAIQGFDDLNAAIDAC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12057NP_001259379.1 DUF725 79..198 CDD:283039 37/122 (30%)
CG12115NP_572533.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0020084
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.