DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3.3B and HHT1

DIOPT Version :9

Sequence 1:NP_001259374.1 Gene:His3.3B / 31848 FlyBaseID:FBgn0004828 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_009564.1 Gene:HHT1 / 852295 SGDID:S000000214 Length:136 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:123/136 - (90%)
Similarity:131/136 - (96%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            ||||||||||||||||||||||:|||||||||||||||||||:|||||||||||:||||||||||
Yeast     1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||||||||||||:|||||||:.|||||.|||||||.|||||||||..|||:||||
Yeast    66 LPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARR 130

  Fly   131 IRGERA 136
            :||||:
Yeast   131 LRGERS 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3.3BNP_001259374.1 PTZ00018 1..136 CDD:185400 122/134 (91%)
HHT1NP_009564.1 PTZ00018 1..136 CDD:185400 122/134 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I393
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 242 1.000 Inparanoid score I685
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 1 1.000 - - otm46875
orthoMCL 1 0.900 - - OOG6_100119
Panther 1 1.100 - - LDO PTHR11426
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X183
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.