DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3.3B and HTR11

DIOPT Version :9

Sequence 1:NP_001259374.1 Gene:His3.3B / 31848 FlyBaseID:FBgn0004828 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_201338.1 Gene:HTR11 / 836660 AraportID:AT5G65350 Length:139 Species:Arabidopsis thaliana


Alignment Length:136 Identity:123/136 - (90%)
Similarity:133/136 - (97%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||.||||||||||||.||||:|||:|||||||||:||||||||:||:||||||:||||
plant     1 MARTKQTARISTGGKAPRKQLAPKAARQSAPATGGVKKPHRFRPGTVALRDIRKYQKSTEILIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||||||||||||:|:.|||||:||||||||||||||||||||||||||:||||||
plant    66 LPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKEIQLARR 130

  Fly   131 IRGERA 136
            ||||||
plant   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3.3BNP_001259374.1 PTZ00018 1..136 CDD:185400 121/134 (90%)
HTR11NP_201338.1 PTZ00018 1..136 CDD:185400 121/134 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11426
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X183
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.