DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3.3B and cnp1

DIOPT Version :9

Sequence 1:NP_001259374.1 Gene:His3.3B / 31848 FlyBaseID:FBgn0004828 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_596473.1 Gene:cnp1 / 2539658 PomBaseID:SPBC1105.17 Length:120 Species:Schizosaccharomyces pombe


Alignment Length:118 Identity:75/118 - (63%)
Similarity:93/118 - (78%) Gaps:10/118 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ARKSAPSTGG--VKKPH--RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQD----FKTD 82
            |:||..:..|  :.:|.  ||||||.||||||:||:||:|||::|||.|:||||:.:    |.||
pombe     2 AKKSLMAEPGDPIPRPRKKRYRPGTTALREIRKYQRSTDLLIQRLPFSRIVREISSEFVANFSTD 66

  Fly    83 --LRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRG 133
              ||:||.|:..||||:||:||.||||||||||||||||||.:|:||||||||
pombe    67 VGLRWQSTALQCLQEAAEAFLVHLFEDTNLCAIHAKRVTIMQRDMQLARRIRG 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3.3BNP_001259374.1 PTZ00018 1..136 CDD:185400 75/118 (64%)
cnp1NP_596473.1 Histone 1..118 CDD:278551 72/115 (63%)
H4 19..119 CDD:304892 68/99 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.