DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3.3B and H3f3a

DIOPT Version :10

Sequence 1:NP_511095.1 Gene:His3.3B / 31848 FlyBaseID:FBgn0004828 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_032236.1 Gene:H3f3a / 15078 MGIID:1097686 Length:136 Species:Mus musculus


Alignment Length:136 Identity:136/136 - (100%)
Similarity:136/136 - (100%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Fly   131 IRGERA 136
            ||||||
Mouse   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3.3BNP_511095.1 PTZ00018 1..136 CDD:185400 134/134 (100%)
H3f3aNP_032236.1 PTZ00018 1..136 CDD:185400 134/134 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 41/41 (100%)

Return to query results.
Submit another query.