DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3.3B and H3f3bl2

DIOPT Version :10

Sequence 1:NP_511095.1 Gene:His3.3B / 31848 FlyBaseID:FBgn0004828 Length:136 Species:Drosophila melanogaster
Sequence 2:XP_017445789.1 Gene:H3f3bl2 / 108349691 RGDID:11381356 Length:136 Species:Rattus norvegicus


Alignment Length:136 Identity:133/136 - (97%)
Similarity:134/136 - (98%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||:.||||||||||||||||||||||||||||||||||||||
  Rat     1 MARTKQTARKSTGGKAPRKQLATKASHKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Fly   131 IRGERA 136
            |.||||
  Rat   131 ILGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3.3BNP_511095.1 PTZ00018 1..136 CDD:185400 131/134 (98%)
H3f3bl2XP_017445789.1 PTZ00018 1..136 CDD:185400 131/134 (98%)

Return to query results.
Submit another query.