DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3.3B and CENPA

DIOPT Version :9

Sequence 1:NP_001259374.1 Gene:His3.3B / 31848 FlyBaseID:FBgn0004828 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001800.1 Gene:CENPA / 1058 HGNCID:1851 Length:140 Species:Homo sapiens


Alignment Length:132 Identity:68/132 - (51%)
Similarity:83/132 - (62%) Gaps:9/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RKSTGGKAPRKQ----LATKAARKSAPSTGGVKKPH-RYRPGTVALREIRRYQKSTELLIRKLPF 68
            |:|...:|||::    ..|....:..||.|.....| |.|.|.  |:|||:.||||.||||||||
Human     5 RRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGW--LKEIRKLQKSTHLLIRKLPF 67

  Fly    69 QRLVREIAQDFK--TDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 131
            .||.|||...|.  .|..:|:.|:.|||||:||:||.||||..|..:||.|||:.|||:||||||
Human    68 SRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRI 132

  Fly   132 RG 133
            ||
Human   133 RG 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3.3BNP_001259374.1 PTZ00018 1..136 CDD:185400 68/132 (52%)
CENPANP_001800.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 12/40 (30%)
H3 34..137 CDD:128705 60/103 (58%)
Important for flexibility of DNA ends that protrude from nucleosomes. /evidence=ECO:0000269|PubMed:27499292 39..54 8/16 (50%)
CATD. /evidence=ECO:0000269|PubMed:15282608, ECO:0000269|PubMed:7962047 75..116 18/40 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.