Sequence 1: | NP_572530.1 | Gene: | Bap111 / 31846 | FlyBaseID: | FBgn0030093 | Length: | 749 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523830.2 | Gene: | Ssrp / 37767 | FlyBaseID: | FBgn0010278 | Length: | 723 | Species: | Drosophila melanogaster |
Alignment Length: | 199 | Identity: | 47/199 - (23%) |
---|---|---|---|
Similarity: | 73/199 - (36%) | Gaps: | 62/199 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 SRSSGGGGGGDRNKDQTPIFTHSNYGNPAFTPQKVTKSSSSKNQNE------SRLPKPPK----- 87
Fly 88 -PPEKPILPYMRYSKRVWDSVKAKHPELKLWELGKKIGAMWKLLPEDEKTEFIDEYEAEKLEYEK 151
Fly 152 SLKAYHQTPAYQAYMSAKSKVKTDVDMHETPSRGG------GSKSQHERRIDIQPAEDEDDQDEG 210
Fly 211 YTTK 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Bap111 | NP_572530.1 | HMGB-UBF_HMG-box | 95..154 | CDD:238686 | 18/58 (31%) |
Ssrp | NP_523830.2 | POB3 | 20..499 | CDD:227494 | |
SSrecog | 75..284 | CDD:281523 | |||
PH2_SSRP1-like | 332..427 | CDD:270051 | |||
HMG_box | 557..620 | CDD:278906 | 18/64 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45450764 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |