DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap111 and Ssrp

DIOPT Version :9

Sequence 1:NP_572530.1 Gene:Bap111 / 31846 FlyBaseID:FBgn0030093 Length:749 Species:Drosophila melanogaster
Sequence 2:NP_523830.2 Gene:Ssrp / 37767 FlyBaseID:FBgn0010278 Length:723 Species:Drosophila melanogaster


Alignment Length:199 Identity:47/199 - (23%)
Similarity:73/199 - (36%) Gaps:62/199 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SRSSGGGGGGDRNKDQTPIFTHSNYGNPAFTPQKVTKSSSSKNQNE------SRLPKPPK----- 87
            |.:|||||..|..|                  :|..|.|..|.:.|      .|..||.|     
  Fly   506 SDASGGGGDSDGAK------------------KKKEKKSEKKEKKEKKHKEKERTKKPSKKKKDS 552

  Fly    88 -PPEKPILPYMRYSKRVWDSVKAKHPELKLWELGKKIGAMWKLLPEDEKTEFIDEYEAEKLEYEK 151
             .|::....:|.:.....:|:|.::|.:|:.|:.||.|.|||.|.:..|.|  |....:|..|..
  Fly   553 GKPKRATTAFMLWLNDTRESIKRENPGIKVTEIAKKGGEMWKELKDKSKWE--DAAAKDKQRYHD 615

  Fly   152 SLKAYHQTPAYQAYMSAKSKVKTDVDMHETPSRGG------GSKSQHERRIDIQPAEDEDDQDEG 210
            .::.|                        .|..||      |.||..:|:.:..|::..:....|
  Fly   616 EMRNY------------------------KPEAGGDSDNEKGGKSSKKRKTEPSPSKKANTSGSG 656

  Fly   211 YTTK 214
            :.:|
  Fly   657 FKSK 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap111NP_572530.1 HMGB-UBF_HMG-box 95..154 CDD:238686 18/58 (31%)
SsrpNP_523830.2 POB3 20..499 CDD:227494
SSrecog 75..284 CDD:281523
PH2_SSRP1-like 332..427 CDD:270051
HMG_box 557..620 CDD:278906 18/64 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450764
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.