DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap111 and Hmg-2

DIOPT Version :9

Sequence 1:NP_572530.1 Gene:Bap111 / 31846 FlyBaseID:FBgn0030093 Length:749 Species:Drosophila melanogaster
Sequence 2:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster


Alignment Length:344 Identity:74/344 - (21%)
Similarity:113/344 - (32%) Gaps:128/344 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 TEFIDEYEAEKLEYEKSLKAYHQTPAYQAYMSAKSKVKTDVDMHETPSRGGGSKSQHERRIDIQP 200
            |..|::::.:|             ||     ..|.|.|.....|.....|...|...:|||::..
  Fly    28 TATIEDFDEDK-------------PA-----KGKKKAKNPKGRHSDSDIGSELKKLAQRRINVAG 74

  Fly   201 AEDEDDQDEGYTTKHLAYARYLHNHRLINEIFSEAVVPDVRSVVTTTRMQVLKRQVSSLTMHQTK 265
            |......         .|.|::::.|  .|:..|.  |. |:.:..||       :.....||..
  Fly    75 APKMPLN---------GYVRFMNDRR--EELRREQ--PQ-RTALEHTR-------IIGEEWHQLP 118

  Fly   266 LEAELQQMEEKFEAKKQRMVESSEAFQEELKRHCKPAVDEETFQKMVLRMYEDIKRDRQRLDEPN 330
            .|.:|..:|   .|.|.:.:     :||:|              :|.|:.:.:|           
  Fly   119 EERKLPYIE---AAAKDKAI-----YQEQL--------------QMFLKEHPEI----------- 150

  Fly   331 ANANSAANPAAAAATAAAAPVTRSEEAVKPPTQPGQPAATPAGQEPASAVPAPAAPPKETPPA-V 394
                 .||..|.|..|     |:.:.:.|..|..|:.|...|.:..|..|...:..|.:.|.| |
  Fly   151 -----VANELAKAKKA-----TKLDGSPKEKTPKGESALGKAKKTKAKPVKRQSEDPDDVPLAKV 205

  Fly   395 KPATLNPTPSSTPTPAPAVHVHETASKTDPEPMDIEPPPKPSVPPPPIKPEKLEMAAALPPQSTL 459
            |.|                                :.||.|:.|..|::|         ||.|. 
  Fly   206 KRA--------------------------------QTPPPPTPPAAPVQP---------PPSSV- 228

  Fly   460 VEPPKTEPAKVVAQPGKVP 478
              ||.| ||....|||::|
  Fly   229 --PPAT-PAPRPLQPGEIP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap111NP_572530.1 HMGB-UBF_HMG-box 95..154 CDD:238686 3/17 (18%)
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 19/107 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450775
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.