Sequence 1: | NP_572530.1 | Gene: | Bap111 / 31846 | FlyBaseID: | FBgn0030093 | Length: | 749 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498633.1 | Gene: | hmg-4 / 176052 | WormBaseID: | WBGene00001974 | Length: | 697 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 50/197 - (25%) |
---|---|---|---|
Similarity: | 78/197 - (39%) | Gaps: | 33/197 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 GGGS------GGGSRSRSSGGGGGGDRNKDQTPIFTHSNYGNPAFTPQKVTKSSSSKNQNESRLP 83
Fly 84 KPPKPPEKPILPYMRYSKRVWDSVKAKHPELK-----LWELGKKIGAMWKLLPEDEKTEFIDEYE 143
Fly 144 AEKLEYEKSLKAYHQT-PAYQAYMSAKSKVKTDVDMHETPSRGGGSKSQHERRIDIQPAEDEDDQ 207
Fly 208 DE 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Bap111 | NP_572530.1 | HMGB-UBF_HMG-box | 95..154 | CDD:238686 | 19/63 (30%) |
hmg-4 | NP_498633.1 | SSrecog | 75..285 | CDD:281523 | |
PH2_SSRP1-like | 332..429 | CDD:270051 | |||
HMGB-UBF_HMG-box | 556..619 | CDD:238686 | 20/69 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160160108 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |