DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap111 and hmg-4

DIOPT Version :9

Sequence 1:NP_572530.1 Gene:Bap111 / 31846 FlyBaseID:FBgn0030093 Length:749 Species:Drosophila melanogaster
Sequence 2:NP_498633.1 Gene:hmg-4 / 176052 WormBaseID:WBGene00001974 Length:697 Species:Caenorhabditis elegans


Alignment Length:197 Identity:50/197 - (25%)
Similarity:78/197 - (39%) Gaps:33/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GGGS------GGGSRSRSSGGGGGGDRNKDQTPIFTHSNYGNPAFTPQKVTKSSSSKNQNESRLP 83
            |.||      ..||...|||.|.....::...|  :....|.|....:|..| ...|...:.:..
 Worm   489 GTGSEPDDEYDSGSEQDSSGTGESEPDSEQDVP--SKRRKGEPKEKREKKEK-REKKEGKKGKKD 550

  Fly    84 KPPKPPEKPILPYMRYSKRVWDSVKAKHPELK-----LWELGKKIGAMWKLLPEDEKTEFIDEYE 143
            |.|..|::....||::       ..|...|||     :.::.||.||.||.:..|:|.::.::.|
 Worm   551 KDPNAPKRATSAYMQW-------FLASRNELKEDGDSVADVAKKGGAKWKTMSSDDKKKWEEKAE 608

  Fly   144 AEKLEYEKSLKAYHQT-PAYQAYMSAKSKVKTDVDMHETPSRGGGSKSQHERRIDIQPAEDEDDQ 207
            .:|..|||.:|.|.:. |...:...:.||         |..:..|..|  .:.|..:...|.||.
 Worm   609 EDKSRYEKEMKEYRKNGPPSSSSKPSSSK---------TSKKSSGPSS--SKAISKEYISDSDDS 662

  Fly   208 DE 209
            |:
 Worm   663 DD 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap111NP_572530.1 HMGB-UBF_HMG-box 95..154 CDD:238686 19/63 (30%)
hmg-4NP_498633.1 SSrecog 75..285 CDD:281523
PH2_SSRP1-like 332..429 CDD:270051
HMGB-UBF_HMG-box 556..619 CDD:238686 20/69 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160108
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.