DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fh and cyaY

DIOPT Version :10

Sequence 1:NP_511094.1 Gene:fh / 31845 FlyBaseID:FBgn0030092 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_418251.1 Gene:cyaY / 947754 ECOCYCID:EG11653 Length:106 Species:Escherichia coli


Alignment Length:70 Identity:24/70 - (34%)
Similarity:38/70 - (54%) Gaps:8/70 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 DVAYSDGVLTVNLGGQHGT-YVINRQTPNKQIWLSSPTSGPKRYDFVGTVAAGRWIYKHSGQSLH 165
            |...:.||||:..  ::|: .:||||.|..|:||::...|   |.|  .:....||...||::..
E. coli    31 DCEINGGVLTITF--ENGSKIIINRQEPLHQVWLATKQGG---YHF--DLKGDEWICDRSGETFW 88

  Fly   166 ELLQQ 170
            :||:|
E. coli    89 DLLEQ 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fhNP_511094.1 mito_frataxin 72..173 CDD:132463 24/70 (34%)
cyaYNP_418251.1 cyaY 1..106 CDD:234765 24/70 (34%)

Return to query results.
Submit another query.