DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fh and YFH1

DIOPT Version :9

Sequence 1:NP_511094.1 Gene:fh / 31845 FlyBaseID:FBgn0030092 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_010163.1 Gene:YFH1 / 851437 SGDID:S000002278 Length:174 Species:Saccharomyces cerevisiae


Alignment Length:128 Identity:51/128 - (39%)
Similarity:67/128 - (52%) Gaps:19/128 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 ESTLDGAT------------YERVCSDTLDALCDYFEELTENASELQGTDVAYSDGVLTVNLGGQ 117
            ||:.||..            |.....|.||.|.|..|||:|...:.. .||..|.||:|:.:.. 
Yeast    53 ESSTDGQVVPQEVLNLPLEKYHEEADDYLDHLLDSLEELSEAHPDCI-PDVELSHGVMTLEIPA- 115

  Fly   118 HGTYVINRQTPNKQIWLSSPTSGPKRYDFVGTVAAGRWIYKHSGQSLHELLQQEI-PGILKSQ 179
            .||||||:|.|||||||:||.|||.|:|.:.    |.|:...:|..|.::|.:|: ..|.|||
Yeast   116 FGTYVINKQPPNKQIWLASPLSGPNRFDLLN----GEWVSLRNGTKLTDILTEEVEKAISKSQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fhNP_511094.1 mito_frataxin 72..173 CDD:132463 43/113 (38%)
YFH1NP_010163.1 mito_frataxin 72..168 CDD:132463 43/101 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344162
Domainoid 1 1.000 77 1.000 Domainoid score I2098
eggNOG 1 0.900 - - E1_COG1965
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1633
Isobase 1 0.950 - 0 Normalized mean entropy S1580
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004275
OrthoInspector 1 1.000 - - oto100231
orthoMCL 1 0.900 - - OOG6_102217
Panther 1 1.100 - - LDO PTHR16821
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R456
SonicParanoid 1 1.000 - - X3009
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.