DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fh and FH

DIOPT Version :9

Sequence 1:NP_511094.1 Gene:fh / 31845 FlyBaseID:FBgn0030092 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_192233.2 Gene:FH / 828013 AraportID:AT4G03240 Length:187 Species:Arabidopsis thaliana


Alignment Length:124 Identity:48/124 - (38%)
Similarity:77/124 - (62%) Gaps:8/124 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RLFSSQ----IETESTLDGATYERVCSDTLDALCDYFEELTENASELQGTDVAYSDGVLTVNLGG 116
            |.||||    ::..|.|....:.::.:.|::.|.:..|:..:|. ::.|.|:.|.:.|||:.||.
plant    60 RSFSSQGPASVDYSSVLQEEEFHKLANFTINHLLEKIEDYGDNV-QIDGFDIDYGNEVLTLKLGS 123

  Fly   117 QHGTYVINRQTPNKQIWLSSPTSGPKRYDFVGTVAAGRWIYKHSGQSLHELLQQEIPGI 175
            . ||||:|:||||:|||:|||.|||.|:|:  ...|..|||:.:...||:||::|:..:
plant   124 L-GTYVLNKQTPNRQIWMSSPVSGPSRFDW--DRDANAWIYRRTEAKLHKLLEEELENL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fhNP_511094.1 mito_frataxin 72..173 CDD:132463 41/100 (41%)
FHNP_192233.2 mito_frataxin 80..170 CDD:132463 37/93 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 85 1.000 Domainoid score I2837
eggNOG 1 0.900 - - E1_COG1965
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I2275
OMA 1 1.010 - - QHG60238
OrthoDB 1 1.010 - - D1372185at2759
OrthoFinder 1 1.000 - - FOG0004275
OrthoInspector 1 1.000 - - oto2882
orthoMCL 1 0.900 - - OOG6_102217
Panther 1 1.100 - - LDO PTHR16821
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3009
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.