DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fh and fxn

DIOPT Version :9

Sequence 1:NP_511094.1 Gene:fh / 31845 FlyBaseID:FBgn0030092 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001076485.1 Gene:fxn / 556389 ZFINID:ZDB-GENE-070209-286 Length:169 Species:Danio rerio


Alignment Length:148 Identity:73/148 - (49%)
Similarity:93/148 - (62%) Gaps:14/148 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QCEEFTANRR--LFSSQIETEST-----LDGATYERVCSDTLDALCDYFEELT-ENASELQGTDV 103
            ||.:...|:|  ..|..:..|..     :..|.|||:..:|||||.||||:|| ||.:.|. .||
Zfish    25 QCFDRILNKRDLHLSGPLGEEKAHHLREISEAEYERLAEETLDALADYFEDLTDENFTGLD-YDV 88

  Fly   104 AYSDGVLTVNLGGQHGTYVINRQTPNKQIWLSSPTSGPKRYDFVGTVAAGRWIYKHSGQSLHELL 168
            .:|:|||||.:|..|||||||:||||:|||||||||||||||:.|.    ||:|.|....||.||
Zfish    89 VFSNGVLTVKVGSDHGTYVINKQTPNRQIWLSSPTSGPKRYDWTGE----RWVYTHDAVPLHSLL 149

  Fly   169 QQEIPGILKSQSVDFLRL 186
            .:|:..|.|: ::|...|
Zfish   150 SKELSIIFKT-NIDLSHL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fhNP_511094.1 mito_frataxin 72..173 CDD:132463 62/101 (61%)
fxnNP_001076485.1 Frataxin_Cyay 54..161 CDD:279789 65/112 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582018
Domainoid 1 1.000 128 1.000 Domainoid score I5291
eggNOG 1 0.900 - - E1_COG1965
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4639
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1372185at2759
OrthoFinder 1 1.000 - - FOG0004275
OrthoInspector 1 1.000 - - oto39819
orthoMCL 1 0.900 - - OOG6_102217
Panther 1 1.100 - - LDO PTHR16821
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R456
SonicParanoid 1 1.000 - - X3009
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.