DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fh and Fxn

DIOPT Version :9

Sequence 1:NP_511094.1 Gene:fh / 31845 FlyBaseID:FBgn0030092 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001382061.1 Gene:Fxn / 499335 RGDID:1565754 Length:208 Species:Rattus norvegicus


Alignment Length:130 Identity:67/130 - (51%)
Similarity:88/130 - (67%) Gaps:5/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SSQIETESTLDGATYERVCSDTLDALCDYFEELTENASELQGTDVAYSDGVLTVNLGGQHGTYVI 123
            |..:...|:||...|||:..:|||||.::||:|.:....|:..||::.|||||:.|||..|||||
  Rat    79 SGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVI 143

  Fly   124 NRQTPNKQIWLSSPTSGPKRYDFVGTVAAGRWIYKHSGQSLHELLQQEIPGILKSQSVDFLRLPY 188
            |:||||||||||||:|||||||:.|.    .|:|.|.|.||||||.:|:...|.:: :|...|.|
  Rat   144 NKQTPNKQIWLSSPSSGPKRYDWTGK----NWVYSHDGVSLHELLARELTEALNTK-LDLSSLAY 203

  Fly   189  188
              Rat   204  203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fhNP_511094.1 mito_frataxin 72..173 CDD:132463 59/100 (59%)
FxnNP_001382061.1 mito_frataxin 92..190 CDD:132463 59/101 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341958
Domainoid 1 1.000 116 1.000 Domainoid score I5855
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4645
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1372185at2759
OrthoFinder 1 1.000 - - FOG0004275
OrthoInspector 1 1.000 - - oto98517
orthoMCL 1 0.900 - - OOG6_102217
Panther 1 1.100 - - LDO PTHR16821
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3009
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.