DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fh and frh-1

DIOPT Version :9

Sequence 1:NP_511094.1 Gene:fh / 31845 FlyBaseID:FBgn0030092 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_495183.1 Gene:frh-1 / 174002 WormBaseID:WBGene00001486 Length:136 Species:Caenorhabditis elegans


Alignment Length:131 Identity:60/131 - (45%)
Similarity:81/131 - (61%) Gaps:8/131 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RRLFSSQIETESTLDGATYERVCSDTLDALCDYFEELTENASELQGTDVAYSDGVLTVNLGGQHG 119
            ||.|||:|.:::     .||.....||:.|.|||:::.::....:..||:::.||||||:....|
 Worm    12 RRSFSSRIFSQN-----EYETAADSTLERLSDYFDQIADSFPVSEQFDVSHAMGVLTVNVSKSVG 71

  Fly   120 TYVINRQTPNKQIWLSSPTSGPKRYDFVGTVAAGRWIYKHSGQSLHELLQQEIPGILKSQSVDFL 184
            |||||:|:||||||||||.|||||||.   ...|:|.|.|.|:.|..||.:|...||....:||.
 Worm    72 TYVINKQSPNKQIWLSSPMSGPKRYDL---EEEGKWTYAHDGEQLDSLLNREFRKILADDRIDFS 133

  Fly   185 R 185
            |
 Worm   134 R 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fhNP_511094.1 mito_frataxin 72..173 CDD:132463 49/100 (49%)
frh-1NP_495183.1 mito_frataxin 24..123 CDD:132463 49/101 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160045
Domainoid 1 1.000 104 1.000 Domainoid score I4222
eggNOG 1 0.900 - - E1_COG1965
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H122333
Inparanoid 1 1.050 114 1.000 Inparanoid score I3413
Isobase 1 0.950 - 0 Normalized mean entropy S1580
OMA 1 1.010 - - QHG60238
OrthoDB 1 1.010 - - D1372185at2759
OrthoFinder 1 1.000 - - FOG0004275
OrthoInspector 1 1.000 - - oto20473
orthoMCL 1 0.900 - - OOG6_102217
Panther 1 1.100 - - LDO PTHR16821
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R456
SonicParanoid 1 1.000 - - X3009
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1716.790

Return to query results.
Submit another query.