DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fh and Fxn

DIOPT Version :9

Sequence 1:NP_511094.1 Gene:fh / 31845 FlyBaseID:FBgn0030092 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_032070.1 Gene:Fxn / 14297 MGIID:1096879 Length:207 Species:Mus musculus


Alignment Length:214 Identity:80/214 - (37%)
Similarity:112/214 - (52%) Gaps:42/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FAGRLMVRSIVGRACLAT--MG--RWSKP-----------------------QAHASQVILPSTP 39
            |.||..|..:...|..|:  :|  ||.:|                       ..|..|::.....
Mouse     4 FGGRAAVGLLPRTASRASAWVGNPRWREPIVTCGRRGLHVTVNAGATRHAHLNLHYLQILNIKKQ 68

  Fly    40 AIAAVAIQCEEFTANRRLFSSQIETESTLDGATYERVCSDTLDALCDYFEELTENASELQGTDVA 104
            ::..|.:        |.|  ..::..|:||...|||:..:|||:|.::||:|.:....|:..||:
Mouse    69 SVCVVHL--------RNL--GTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVS 123

  Fly   105 YSDGVLTVNLGGQHGTYVINRQTPNKQIWLSSPTSGPKRYDFVGTVAAGRWIYKHSGQSLHELLQ 169
            :.|||||:.|||..||||||:||||||||||||:|||||||:.|.    .|:|.|.|.||||||.
Mouse   124 FGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGK----NWVYSHDGVSLHELLA 184

  Fly   170 QEIPGILKSQSVDFLRLPY 188
            :|:...|.:: :|...|.|
Mouse   185 RELTKALNTK-LDLSSLAY 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fhNP_511094.1 mito_frataxin 72..173 CDD:132463 58/100 (58%)
FxnNP_032070.1 mito_frataxin 91..189 CDD:132463 58/101 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838177
Domainoid 1 1.000 128 1.000 Domainoid score I5341
eggNOG 1 0.900 - - E1_COG1965
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4546
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004275
OrthoInspector 1 1.000 - - oto95018
orthoMCL 1 0.900 - - OOG6_102217
Panther 1 1.100 - - LDO PTHR16821
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R456
SonicParanoid 1 1.000 - - X3009
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.