DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fh and fxn

DIOPT Version :9

Sequence 1:NP_511094.1 Gene:fh / 31845 FlyBaseID:FBgn0030092 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_017944796.1 Gene:fxn / 100497789 XenbaseID:XB-GENE-984730 Length:233 Species:Xenopus tropicalis


Alignment Length:154 Identity:65/154 - (42%)
Similarity:89/154 - (57%) Gaps:32/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IETESTLDGATYERVCSDTLDALCDYFEELTENASELQGTDVAY--------------------- 105
            :...|:||..|||::..:|||:|.::||:|.:.....:..||::                     
 Frog    79 LSNTSSLDETTYEKLAEETLDSLAEFFEDLADQPFTPEDYDVSFGLQILNVLWAAAEKQNMGAIS 143

  Fly   106 ------SDGVLTVNLGGQHGTYVINRQTPNKQIWLSSPTSGPKRYDFVGTVAAGRWIYKHSGQSL 164
                  .:|||||.|||..||||||:||||||||||||||||||||:.|..    |:|.|.|.:|
 Frog   144 NHQAKNKNGVLTVKLGGDMGTYVINKQTPNKQIWLSSPTSGPKRYDWTGRT----WVYSHDGVAL 204

  Fly   165 HELLQQEIPGILKSQSVDFLRLPY 188
            ||||.:|:..:||:: :|...|.|
 Frog   205 HELLAKELSAVLKNK-IDLSNLLY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fhNP_511094.1 mito_frataxin 72..173 CDD:132463 57/127 (45%)
fxnXP_017944796.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I5215
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4436
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1372185at2759
OrthoFinder 1 1.000 - - FOG0004275
OrthoInspector 1 1.000 - - oto105203
Panther 1 1.100 - - LDO PTHR16821
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3009
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.