DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1gamma and AT4G10060

DIOPT Version :10

Sequence 1:NP_788891.2 Gene:AP-1gamma / 31842 FlyBaseID:FBgn0030089 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_192744.6 Gene:AT4G10060 / 826597 AraportID:AT4G10060 Length:922 Species:Arabidopsis thaliana


Alignment Length:79 Identity:15/79 - (18%)
Similarity:35/79 - (44%) Gaps:16/79 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   860 VPP----QGPRLTALDKDGLLVQLVSVRGSDCMRIYMTTTNNSDNTLDQYLLQAAVQ-------- 912
            :||    :..::|..:::.:::.|.....:.|.:||...::||:..:.|::....::        
plant   446 LPPKESIERSKVTNTEQNDIVIDLFQKINAVCEQIYSPQSSNSEENIGQFIYLEGIEYLMYNTYD 510

  Fly   913 ----RSFQLQMLTP 922
                .||.|..|.|
plant   511 VHFYSSFALLSLFP 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1gammaNP_788891.2 Adaptin_N 68..624 CDD:396262
Alpha_adaptinC2 869..972 CDD:197886 12/66 (18%)
AT4G10060NP_192744.6 COG4354 99..858 CDD:443491 15/79 (19%)
DUF608 493..853 CDD:461391 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.