DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1gamma and gba2

DIOPT Version :9

Sequence 1:NP_788891.2 Gene:AP-1gamma / 31842 FlyBaseID:FBgn0030089 Length:982 Species:Drosophila melanogaster
Sequence 2:XP_005172389.1 Gene:gba2 / 559240 ZFINID:ZDB-GENE-070522-3 Length:851 Species:Danio rerio


Alignment Length:239 Identity:47/239 - (19%)
Similarity:79/239 - (33%) Gaps:73/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 LGAIASPEMARDLASEVERLMKSPNTY-----IRKKATLCAFRVIRRVPELM--EIFLPATRSLL 224
            ||.|....:.|....|..|...:|..|     |..:.|:|    :||..:.:  ::......|.|
Zfish    98 LGGIGGGSITRGWRGEFCRWQLNPGMYHYKTVIANQFTVC----LRRDGQTVYQQVLSTERPSTL 158

  Fly   225 SEKN----------HGILITGVTL-------ITEMCENSSDTLMHFKKDSGNREIVPNLVRILKN 272
            ...|          ||:.....|:       :|..|...|..:.|..|||.    :|..|.:   
Zfish   159 QGWNWGYCGEHAFYHGLFPRAWTVYNLPGQNVTLTCRQVSPVIPHDYKDSS----LPVAVFV--- 216

  Fly   273 LILGGYSPEHDVSGVSDPFLQVKILRLL---------RILGH-NDPDASEAMNDILAQVATNTET 327
                     .|:...:|..|.:.|:..:         :..|| |:|...|...:.::.|..:.:|
Zfish   217 ---------WDIENKNDYALDISIMFTMVNGSGQKDDKSGGHWNEPFHLEKEGESVSGVLLHHQT 272

  Fly   328 SKN-----------VGNTILYETVLS--------IMDIRSEGGL 352
            ..|           .|..|.::|..|        ..|:.::|.|
Zfish   273 PANPYTLCIAARQKSGQEISHQTAFSPKGTCSAVWCDLMTDGRL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1gammaNP_788891.2 Adaptin_N 68..624 CDD:279882 47/239 (20%)
Alpha_adaptinC2 869..972 CDD:197886
gba2XP_005172389.1 GBA2_N 105..399 CDD:289023 44/232 (19%)
DUF608 469..836 CDD:282531
GDE_C <567..>694 CDD:283786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4354
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.