DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1gamma and CG33090

DIOPT Version :9

Sequence 1:NP_788891.2 Gene:AP-1gamma / 31842 FlyBaseID:FBgn0030089 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_788055.2 Gene:CG33090 / 34835 FlyBaseID:FBgn0028916 Length:948 Species:Drosophila melanogaster


Alignment Length:297 Identity:58/297 - (19%)
Similarity:94/297 - (31%) Gaps:112/297 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 IGYLGAML---------LLDERQDVHLLITNCLKND-------LNSSTQFVVGLALCTLGAIASP 173
            ||||.||.         .::..:|...||.|....|       ::..:.:..||.|..|.|:   
  Fly   685 IGYLKAMYASCKAIMERTIEYDKDNDGLIENTKMPDQTYDSWVMDGPSAYCSGLWLAALQAM--- 746

  Fly   174 EMARDLASEVERLMKSPNTYIRKKATLCAFRVIRRVPELMEIFLPATRSLLSEKNHGILITGVTL 238
                   |.:..::..||..:|                ..:|.....|| |.||    |..|...
  Fly   747 -------SAMATILDQPNDCLR----------------YQDILEKGKRS-LEEK----LWNGSYY 783

  Fly   239 ITEMCENSSDTLM--------HFKKDSGNREIVPN------LVRILKNLILG----------GYS 279
            ..::..:..||:|        :.|....:.||.|.      |.||..|.::|          |: 
  Fly   784 RFDLSHSHRDTIMADQLCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVMGFHEGNIGAANGF- 847

  Fly   280 PEHDVSGVSDPFLQVKILRLLRILGHND----------PDASEAMNDILAQVATNTETSKNVGNT 334
                ::..|:|...          ||.|          |....|:...:.|.....|..:..|. 
  Fly   848 ----IANASEPTKP----------GHVDNSNIQAEEVWPGVVYALAATMIQEGMFEEAFQTAGG- 897

  Fly   335 ILYETVLSIMDI--------------RSEGGLRVLAV 357
             :|:|:...:.:              ||.|.:|.|::
  Fly   898 -MYKTLSQRIGMNFETPEALYGEKRYRSIGYMRPLSI 933

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1gammaNP_788891.2 Adaptin_N 68..624 CDD:279882 58/297 (20%)
Alpha_adaptinC2 869..972 CDD:197886
CG33090NP_788055.2 GBA2_N 132..445 CDD:289023
DUF608 505..937 CDD:282531 58/297 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4354
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.