DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1gamma and R08F11.1

DIOPT Version :9

Sequence 1:NP_788891.2 Gene:AP-1gamma / 31842 FlyBaseID:FBgn0030089 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_001317760.1 Gene:R08F11.1 / 187703 WormBaseID:WBGene00019965 Length:819 Species:Caenorhabditis elegans


Alignment Length:216 Identity:46/216 - (21%)
Similarity:85/216 - (39%) Gaps:60/216 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 AQCSSGMILAAERY--------SPTTRWHLDTQLSVLIAA-------GNYVRDDVVSSTIQLVSS 494
            |.|.|..|.|...|        .||.  |.:.:|.:...|       |.:.:.|.:....::|.:
 Worm   616 AYCGSLWIAALSSYIEMLKQSGLPTK--HYEEKLEMAYDAYIGKLWNGTFFKFDELPENSKIVMA 678

  Fly   495 SPVPEQTYITNRFW------ESLQVANHCEDKQPLLQVAVWAIGEYGDLFMYGANEDEFERPTES 553
            ..:       ..||      |.:|::   :||   ::.|:..|.:| ::.||           .:
 Worm   679 DQL-------CGFWAMTAMDEPVQIS---KDK---MKSALDTIFKY-NVQMY-----------NN 718

  Fly   554 DLIAVYYKFLTSAQVSTTSKQ----YALVSLAKLSTRLQQCVEEIQALITSFGSHLNV----DLQ 610
            ........:|||.:|..:|.|    :|.::.|..:..:::.::| ||..||.|...::    .||
 Worm   719 GRCGAVNGYLTSERVDGSSIQSEEVWAGITYALSAMMIEKGMDE-QAFKTSEGLFESIWHRFPLQ 782

  Fly   611 QRGVEFTQLFGHYK---HLRP 628
            .:..|.....|.|:   ::||
 Worm   783 YQTPEAITSDGMYRALGYMRP 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1gammaNP_788891.2 Adaptin_N 68..624 CDD:279882 43/207 (21%)
Alpha_adaptinC2 869..972 CDD:197886
R08F11.1NP_001317760.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4354
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.