DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and ARL6

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001310442.1 Gene:ARL6 / 84100 HGNCID:13210 Length:193 Species:Homo sapiens


Alignment Length:179 Identity:60/179 - (33%)
Similarity:92/179 - (51%) Gaps:20/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNIGTIDVQGVRLNFWDLGG 78
            :|.:..|:.|||||:||||.:...|.:   |.:..|   |..|:|.:|.......:....:|:.|
Human    14 KKKEVHVLCLGLDNSGKTTIINKLKPS---NAQSQN---ILPTIGFSIEKFKSSSLSFTVFDMSG 72

  Fly    79 QQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLS--GVPLLILANKQDLPDV 141
            |...::||:.||:|...:|:||||:||.||..:|...|.::.:..:.  .:|:|..|||.||.| 
Human    73 QGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRD- 136

  Fly   142 MGVREIKPVFQQAGALIGRRD-----CLTIPVSALHGEGVDEGIKWLVE 185
             .|..:|  ..|...|...:|     |.:   .|:.|||:.||:.||.|
Human   137 -AVTSVK--VSQLLCLENIKDKPWHICAS---DAIKGEGLQEGVDWLQE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 56/170 (33%)
Arfrp1 19..186 CDD:206725 59/174 (34%)
ARL6NP_001310442.1 Arl6 19..180 CDD:206722 59/174 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.