DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and ARFD1B

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_171745.3 Gene:ARFD1B / 839242 AraportID:AT1G02430 Length:190 Species:Arabidopsis thaliana


Alignment Length:208 Identity:61/208 - (29%)
Similarity:103/208 - (49%) Gaps:54/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GFYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNIGTIDVQGVR- 70
            ||:    .:::..:|:.|||.|||::.:...||..|          :|||:. .||| ||:.|: 
plant    11 GFF----HQEESRIVLFGLDAAGKSSIMHKLKTGET----------LTTTMP-TIGT-DVESVKY 59

  Fly    71 ----LNFWDLGGQQELQSLW---DKY-YQESHGVIYVIDSNDRERMEESK----AIFDKMIKNEL 123
                |.||::||||..:  |   .|: :||..|::.|:||.||:|:|::|    |:.|: |:..:
plant    60 KDSNLRFWEMGGQQCYK--WFPMTKHDFQEIAGLVLVVDSTDRDRIEDAKDFLNAVIDE-IQGSV 121

  Fly   124 LSGVPLLILANKQDLPDVMGVREIKPVFQQAGALIGRRDCLTI------------PVSALHGEGV 176
            ...|.:|:..||.::|..|...||.          .:.|..::            ...|..|:|:
plant   122 PDNVAVLVFGNKHEVPGAMSASEIS----------NKLDLTSLRQKNWQRNWHVQSSCAFSGDGL 176

  Fly   177 DEGIKWLVEAIKR 189
            .||:.||::..:|
plant   177 HEGLDWLLKNAER 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 56/188 (30%)
Arfrp1 19..186 CDD:206725 58/191 (30%)
ARFD1BNP_171745.3 Arf_Arl 19..186 CDD:206644 58/191 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.