DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and ARFD1A

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_563652.1 Gene:ARFD1A / 839230 AraportID:AT1G02440 Length:190 Species:Arabidopsis thaliana


Alignment Length:202 Identity:57/202 - (28%)
Similarity:100/202 - (49%) Gaps:42/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GFYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITT---TVGLNIGTIDVQG 68
            ||:    .:::..:|:.||...||::.:...||..|          :||   |||||:.::..:.
plant    11 GFF----HQEEARIVLFGLGGTGKSSIMHKFKTGET----------LTTTMPTVGLNVESVKYKD 61

  Fly    69 VRLNFWDLGGQQELQ--SLWDKYYQESHGVIYVIDSNDRERMEESK----AIFDKMIKNELLSGV 127
            ..|.||::||||...  .||..::||..|::.|:||..|:::||:|    .:.|: |:..:....
plant    62 SNLCFWEMGGQQCYMWFPLWKHWFQEIAGLVLVVDSTGRDQIEETKDFLNVVIDE-IQGSVPDNA 125

  Fly   128 PLLILANKQDLPDVMGVREI----------KPVFQQAGALIGRRDCLTIPVSALHGEGVDEGIKW 182
            |:|:..||.::|..|...||          |..:|:...:  :..|      |..|:|:.||:.|
plant   126 PVLVYGNKHEVPGAMSASEISNKLDLTSLRKKNWQRNWHV--QSSC------AFSGDGLHEGLDW 182

  Fly   183 LVEAIKR 189
            |::..:|
plant   183 LLKNAER 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 52/182 (29%)
Arfrp1 19..186 CDD:206725 54/185 (29%)
ARFD1ANP_563652.1 Gem1 15..>145 CDD:224025 42/140 (30%)
Arf_Arl 19..186 CDD:206644 54/185 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.