DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and GB1

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_200034.1 Gene:GB1 / 835297 AraportID:AT5G52210 Length:205 Species:Arabidopsis thaliana


Alignment Length:189 Identity:82/189 - (43%)
Similarity:122/189 - (64%) Gaps:3/189 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYTLMHGFYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNIGTID 65
            |::||.|.:.||..|.::.|:|||:|.|||||:||..||.::.: :||...:|..|||||||.|:
plant     1 MFSLMSGLWSYMFSKTEFNVLILGIDKAGKTTFLEKLKTIYSIS-EGLPHDRIVPTVGLNIGRIE 64

  Fly    66 VQGVRLNFWDLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLL 130
            |...::.|||||||..|:|:|:|||:|:|.:||:||:....|.|:||:..:|.:::|.|.|.|||
plant    65 VSNAKIVFWDLGGQPGLRSIWEKYYEEAHALIYLIDAACPTRFEDSKSALEKALRHEDLQGAPLL 129

  Fly   131 ILANKQDLPDVMGVREIKPVFQQAGALIGRRDCLTIPVSALHGEGVDEGIKWLVEAIKR 189
            ||||||||.:.:...|:......  ..:..|..:...||...|.|:.|.|:|||..:::
plant   130 ILANKQDLTNAVSAEELDRYLDL--KKLDERVYMFEAVSGYDGRGIKESIEWLVGVMEK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 71/163 (44%)
Arfrp1 19..186 CDD:206725 75/166 (45%)
GB1NP_200034.1 Arfrp1 19..183 CDD:206725 75/166 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 150 1.000 Domainoid score I1418
eggNOG 1 0.900 - - E1_KOG0076
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2425
Inparanoid 1 1.050 161 1.000 Inparanoid score I1628
OMA 1 1.010 - - QHG55556
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 1 1.000 - - FOG0005591
OrthoInspector 1 1.000 - - oto3182
orthoMCL 1 0.900 - - OOG6_103510
Panther 1 1.100 - - LDO PTHR45909
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3998
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.930

Return to query results.
Submit another query.