DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and ARLA1C

DIOPT Version :10

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_190556.2 Gene:ARLA1C / 824149 AraportID:AT3G49870 Length:184 Species:Arabidopsis thaliana


Alignment Length:89 Identity:18/89 - (20%)
Similarity:31/89 - (34%) Gaps:30/89 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VKCN-PKVQQDQVNQNANNLMLLPK-------------CLEMIGDK------AKSSELHVAFDV- 49
            ::|: .|..:|..:..:||..||.:             .|:...:|      .|.:.:|....| 
plant    65 IQCSFQKDDEDYEDAPSNNTWLLTRKFHDNDVTSILNGLLKGYDNKLRPDIGVKPTVIHTDMYVN 129

  Fly    50 ---PTNQTTFQYSI------VWED 64
               |.|....:|:|      .|.|
plant   130 SIGPVNAINMEYTIDIFFAQTWYD 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 Arfrp1 19..186 CDD:206725 15/75 (20%)
ARLA1CNP_190556.2 Arl10_like 21..179 CDD:206724 18/89 (20%)

Return to query results.
Submit another query.