DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and ARFB1C

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_186962.1 Gene:ARFB1C / 821079 AraportID:AT3G03120 Length:192 Species:Arabidopsis thaliana


Alignment Length:173 Identity:64/173 - (36%)
Similarity:96/173 - (55%) Gaps:18/173 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTV---GLNIGTIDVQGVRLNFWDLGGQQE 81
            ||:||||.|||||.|          || |:..::.:||   |.|:..:..:.|....||:|||::
plant    20 VVMLGLDAAGKTTIL----------YK-LHIGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEK 73

  Fly    82 LQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLPDVMGVRE 146
            |:.||..|:..:.|:|||:||.||||:.::|..|..:|::..:....:|:.|||||:...|..||
plant    74 LRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQDIIRDPFMLNSVILVFANKQDMRGAMSPRE 138

  Fly   147 IKPVFQQAGAL-IGRRDCLTIPVSALHGEGVDEGIKWLVEAIK 188
               |.:..|.| :..|........||.|:|:.||:.||...:|
plant   139 ---VCEGLGLLDLKNRKWHIQGTCALQGDGLYEGLDWLSATLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 61/164 (37%)
Arfrp1 19..186 CDD:206725 63/169 (37%)
ARFB1CNP_186962.1 Arf1_5_like 18..176 CDD:206717 63/169 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.