DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and ARF3

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_850057.1 Gene:ARF3 / 817014 AraportID:AT2G24765 Length:182 Species:Arabidopsis thaliana


Alignment Length:174 Identity:60/174 - (34%)
Similarity:91/174 - (52%) Gaps:20/174 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITT--TVGLNIGTIDVQGVRLNFWDLGGQQEL 82
            :::||||||||||.|          |:......::|  |:|.|:.|:....::...||||||..:
plant    20 ILVLGLDNAGKTTIL----------YRLQMGEVVSTIPTIGFNVETVQYNNIKFQVWDLGGQTSI 74

  Fly    83 QSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLP---DVMGV 144
            :..|..|:..:..||||:||:|.:|:..:|..|..:::.:.|.|..:||.|||||||   |...|
plant    75 RPYWRCYFPNTQAVIYVVDSSDTDRIGVAKEEFHAILEEDELKGAVVLIFANKQDLPGALDDAAV 139

  Fly   145 REIKPVFQQAGALIGRRDCLTIPVSALHGEGVDEGIKWLVEAIK 188
            .|...:.:     |..|........|:.|||:.||:.||...:|
plant   140 TEALELHK-----IKSRQWAIFKTCAVKGEGLFEGLDWLSNTLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 57/165 (35%)
Arfrp1 19..186 CDD:206725 59/170 (35%)
ARF3NP_850057.1 Arl1 19..176 CDD:206718 59/170 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.