DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and TTN5

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_179430.1 Gene:TTN5 / 816354 AraportID:AT2G18390 Length:185 Species:Arabidopsis thaliana


Alignment Length:178 Identity:65/178 - (36%)
Similarity:102/178 - (57%) Gaps:9/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNIGTIDVQGVRLNFW 74
            |...::.:..::::||||:|        |||......|.:.|.|:.|:|.||.||..|...||.|
plant     9 KIKKKEKEMRILMVGLDNSG--------KTTIVLKINGEDTSVISPTLGFNIKTIIYQKYTLNIW 65

  Fly    75 DLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLP 139
            |:|||:.::|.|..|::::.|:::|:||:|..|:::.|...|.::|.|.|:|..|||||||||:.
plant    66 DVGGQKTIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLAGSSLLILANKQDIQ 130

  Fly   140 DVMGVREIKPVFQQAGALIGRRDCLTIPVSALHGEGVDEGIKWLVEAI 187
            ..:...||..|. ...::...|....:..||..|||:.||..|||:.|
plant   131 GALTPDEIGKVL-NLESMDKSRHWKIVGCSAYTGEGLLEGFDWLVQDI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 60/163 (37%)
Arfrp1 19..186 CDD:206725 63/166 (38%)
TTN5NP_179430.1 Arl2 17..176 CDD:206720 63/167 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.