DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and ARL14

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_079323.1 Gene:ARL14 / 80117 HGNCID:22974 Length:192 Species:Homo sapiens


Alignment Length:174 Identity:64/174 - (36%)
Similarity:107/174 - (61%) Gaps:14/174 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITT--TVGLNIGTIDVQ-GVRLNFWDLGGQQE 81
            |::||||:|||:|.|          ||......|||  |:|.|:..|::: .:.|..||:|||::
Human    16 VLLLGLDSAGKSTLL----------YKLKLAKDITTIPTIGFNVEMIELERNLSLTVWDVGGQEK 70

  Fly    82 LQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLPDVMGVRE 146
            ::::|..|.:.:.|::||:||.|::|:|||:..|:.::|||.:..||:::||||||:|..:...:
Human    71 MRTVWGCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVLLANKQDMPGALTAED 135

  Fly   147 IKPVFQQAGALIGRRDCLTIPVSALHGEGVDEGIKWLVEAIKRH 190
            |..:| :...|...|:....|..||.|||:.:|.:.|...:|.|
Human   136 ITRMF-KVKKLCSDRNWYVQPCCALTGEGLAQGFRKLTGFVKSH 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 61/163 (37%)
Arfrp1 19..186 CDD:206725 62/168 (37%)
ARL14NP_079323.1 SAR 1..175 CDD:197556 62/169 (37%)
ARLTS1 15..174 CDD:133356 62/168 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.