DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and arl13a

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_005173366.1 Gene:arl13a / 793658 ZFINID:ZDB-GENE-040426-1790 Length:434 Species:Danio rerio


Alignment Length:207 Identity:57/207 - (27%)
Similarity:105/207 - (50%) Gaps:37/207 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYTLMHGFYKYMTQKDD----YCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNI 61
            |:.||.....::::...    ..|:::|||.||||:.:        |....:.|..:..|.|...
Zfish    26 MFNLMSNCCSWVSKLQQPLRKITVLVVGLDKAGKTSCV--------RGMLRVPPGDVGPTHGCVR 82

  Fly    62 GTIDVQGVRLNFWDLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSG 126
            ..:.::...:|..|:||..|::..|.::|.|:||:|:|:||:||:||:|.|.....::|:..::|
Zfish    83 TELRLENYLVNILDIGGGLEVRGSWREHYGEAHGIIFVVDSSDRQRMKEVKETLVDLLKHPRVAG 147

  Fly   127 VPLLILANKQDL------PDVMGVREIKPVFQQAGALIGRRDCLTIPVSALHGEGVD-------- 177
            .|||:||||||.      .:::.:..::.:..|:.:|     |...|.||    .:|        
Zfish   148 KPLLVLANKQDKMNALLGNELIEILSLERLVNQSRSL-----CHIEPCSA----SMDLRRWSDRK 203

  Fly   178 --EGIKWLVEAI 187
              .|::||:.|:
Zfish   204 TLRGLRWLLRAV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 51/183 (28%)
Arfrp1 19..186 CDD:206725 53/182 (29%)
arl13aXP_005173366.1 Arl2l1_Arl13_like 48..214 CDD:133361 53/182 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.