DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and Arfrp1

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001159463.1 Gene:Arfrp1 / 76688 MGIID:1923938 Length:201 Species:Mus musculus


Alignment Length:200 Identity:127/200 - (63%)
Similarity:156/200 - (78%) Gaps:1/200 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYTLMHGFYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNIGTID 65
            ||||:.|.||||.|||:||::|||||||||||:||.:||.|.:||||::.|||||||||||||:|
Mouse     1 MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVD 65

  Fly    66 VQGVRLNFWDLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLL 130
            |...||.|||||||:||||||||||.|.|||||||||.|.||:.|||..|:|::.:|.|.|||:|
Mouse    66 VGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLSESKEAFEKVVSSEALDGVPIL 130

  Fly   131 ILANKQDLPDVMGVREIKPVFQQAGALIGRRDCLTIPVSALHGEGVDEGIKWLVEAIKRHAVVRP 195
            :||||||:...:.:.:||..|......||||||||...|||.|:||.|||:|:|:.:.|: |.||
Mouse   131 VLANKQDVETCLSIPDIKTAFSDCTCKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRN-VHRP 194

  Fly   196 PREND 200
            ||:.|
Mouse   195 PRQRD 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 105/163 (64%)
Arfrp1 19..186 CDD:206725 107/166 (64%)
Arfrp1NP_001159463.1 Arfrp1 19..186 CDD:206725 107/166 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835671
Domainoid 1 1.000 242 1.000 Domainoid score I2225
eggNOG 1 0.900 - - E1_KOG0076
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2425
Inparanoid 1 1.050 267 1.000 Inparanoid score I3028
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55556
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005591
OrthoInspector 1 1.000 - - oto94600
orthoMCL 1 0.900 - - OOG6_103510
Panther 1 1.100 - - LDO PTHR45909
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2036
SonicParanoid 1 1.000 - - X3998
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.