DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and arl6

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_021329928.1 Gene:arl6 / 494134 ZFINID:ZDB-GENE-041219-2 Length:194 Species:Danio rerio


Alignment Length:181 Identity:57/181 - (31%)
Similarity:89/181 - (49%) Gaps:20/181 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNIGTIDVQGVRLNFWDLGG 78
            :|.:..|:.|||||:||||.:...|.:      ......|..|:|.:|.......:....:|:.|
Zfish    14 KKKEVNVLCLGLDNSGKTTIINQLKPS------NAQAQDIVPTIGFSIEKFKTSSLSFTVFDMSG 72

  Fly    79 QQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLS--GVPLLILANKQDLPDV 141
            |...::||:.||:|...:|:||||.|:.||..:|...|.::.:..:.  .:|||..|||.||.|.
Zfish    73 QGRYRNLWEHYYKEGQAIIFVIDSGDKLRMVVAKEELDTLLNHPDIKHRRIPLLFFANKMDLRDA 137

  Fly   142 MGVREIKPVFQQAGALIGRRD-----CLTIPVSALHGEGVDEGIKWLVEAI 187
            :...::    .|...|...:|     |.:   .|:.|||:.||:.||.|.|
Zfish   138 LSAVKV----SQLLCLENIKDKPWHICAS---DAVKGEGLLEGVDWLQEQI 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 52/170 (31%)
Arfrp1 19..186 CDD:206725 54/173 (31%)
arl6XP_021329928.1 Arl6 19..180 CDD:206722 54/173 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.