DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and Arl4

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster


Alignment Length:138 Identity:58/138 - (42%)
Similarity:78/138 - (56%) Gaps:21/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VVILGLDNAGKTT---------YLEAAKTTFTRNYKGLNPSKITTTVGLNIGTIDVQGVRLNFWD 75
            ||:||||:|||||         ||....|.      |.|..|:..|:|      ..:||....||
  Fly    28 VVMLGLDSAGKTTALYRLKFDQYLNTVPTI------GFNCEKVQCTLG------KAKGVHFLVWD 80

  Fly    76 LGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLPD 140
            :|||::|:.||..|.:.:.|:::||||.|.|||||:|....:..|.....|||:||||||||||:
  Fly    81 VGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPN 145

  Fly   141 VMGVREIK 148
            ..|..|::
  Fly   146 ACGAMELE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 58/138 (42%)
Arfrp1 19..186 CDD:206725 58/138 (42%)
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 58/138 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455832
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.