DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and dnd

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster


Alignment Length:176 Identity:64/176 - (36%)
Similarity:96/176 - (54%) Gaps:22/176 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITT---TVGLNIGTIDVQGVRLNFWDLGGQQE 81
            :::||||||||||.|           |.|....|||   |.|.||.::...|.:||.||:|||.:
  Fly    20 ILLLGLDNAGKTTIL-----------KQLASEDITTVTPTAGFNIKSVAADGFKLNVWDIGGQWK 73

  Fly    82 LQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLPDVMGVRE 146
            ::..|..|:..:..:|||||..||.|:.|:.:...:|:.:..|..||:||.|||||:||.|...|
  Fly    74 IRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAMSAAE 138

  Fly   147 I---KPVFQQAGALIGRRDCLTIPVSALHGEGVDEGIKWLVEAIKR 189
            :   ..:.|..|.....:.|     :|:.|.|:.||:.|:.:.:|:
  Fly   139 VAEKMSLVQLQGRTWEIKAC-----TAVDGTGLKEGMDWVCKNMKK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 62/166 (37%)
Arfrp1 19..186 CDD:206725 63/171 (37%)
dndNP_650995.1 Arl3 3..176 CDD:206721 63/171 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.