DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and Arl6

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster


Alignment Length:183 Identity:55/183 - (30%)
Similarity:95/183 - (51%) Gaps:20/183 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNIGT--IDVQGVRLNFWDL 76
            :||...:::|||:|:||::.:...|.:..:.      |.:..|||..:..  |.:.||.:...|:
  Fly    14 KKDKMTILVLGLNNSGKSSIINHFKKSSEQT------SIVVPTVGFMVEQFYIGMSGVSIKAIDM 72

  Fly    77 GGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSG--VPLLILANKQDLP 139
            .|....::||:..::..||:||||||:||.|....|...|.::::..|..  ||:|...||.|:.
  Fly    73 SGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDME 137

  Fly   140 DVMGVREIKPVFQQAGAL----IGRRDCLTIPVSALHGEGVDEGIKWLVEAIK 188
            |.:...:|      |.||    |..:.......||:.|||:.||::||::.::
  Fly   138 DSLSSVKI------AAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 51/171 (30%)
Arfrp1 19..186 CDD:206725 53/174 (30%)
Arl6NP_611421.1 Arl6 19..182 CDD:206722 53/174 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455828
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.