DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and Arf51F

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster


Alignment Length:167 Identity:63/167 - (37%)
Similarity:96/167 - (57%) Gaps:16/167 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITT--TVGLNIGTIDVQGVRLNFWDLGGQQEL 82
            :::||||.|||||.|          ||......:||  |||.|:.|:..:.|:.|.||:|||.::
  Fly    16 ILMLGLDAAGKTTIL----------YKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKI 70

  Fly    83 QSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLPDVMGVREI 147
            :.||..||..:.|:|:|:|..||:|::|::....::|.:..:....:||.||||||||.|...||
  Fly    71 RPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPHEI 135

  Fly   148 KPVFQQAG-ALIGRRDCLTIPVSALHGEGVDEGIKWL 183
            :   ::.| ..|..|:....|..|..|:|:.||:.||
  Fly   136 Q---EKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 61/163 (37%)
Arfrp1 19..186 CDD:206725 63/167 (38%)
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 63/167 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.